LL-37: A Comprehensive Research Monograph
An in-depth review of LL-37, the sole human cathelicidin antimicrobial peptide, covering its mechanisms of membrane disruption, immunomodulation, anti-biofilm activity, and research applications in wound healing, innate immunity, and antimicrobial defense.
Overview
LL-37 is a 37-amino acid cationic antimicrobial peptide and the sole member of the cathelicidin family identified in humans. It is derived from the C-terminal proteolytic cleavage of the 18-kDa precursor protein hCAP18 (human cationic antimicrobial protein 18), which is encoded by the CAMP gene on chromosome 3. The name LL-37 reflects the two leucine residues at its N-terminus and its total length of 37 amino acid residues. First characterized in the mid-1990s, LL-37 has since emerged as one of the most extensively studied host defense peptides in biomedical research, with relevance spanning innate immunity, microbiology, wound biology, and inflammation science.
The peptide is primarily produced by neutrophils, where it is stored in the specific (secondary) granules as the inactive proform hCAP18. Upon neutrophil degranulation at sites of infection or tissue injury, hCAP18 is released extracellularly and processed to the mature LL-37 peptide by the serine protease proteinase 3. Beyond neutrophils, LL-37 is also expressed by various epithelial cells lining the respiratory tract, gastrointestinal tract, urogenital tract, and skin, as well as by monocytes, macrophages, mast cells, and natural killer cells. This broad expression pattern underscores the peptide’s fundamental role in first-line host defense across multiple organ systems.
What distinguishes LL-37 from many other antimicrobial agents is its remarkably pleiotropic functional repertoire. In addition to direct antimicrobial activity against gram-positive and gram-negative bacteria, fungi, and certain enveloped viruses, LL-37 functions as a potent immunomodulator, a chemoattractant, an inducer of angiogenesis, and a promoter of wound healing. This multifunctionality has positioned LL-37 at the intersection of innate and adaptive immunity, making it a subject of intense investigation as both a fundamental component of host defense and a template for novel therapeutic development.
Vandamme D, Landuyt B, Luyten W, Schoofs L. A comprehensive summary of LL-37, the factotum human cathelicidin peptide. Cellular Immunology (2012). DOI: 10.1016/j.cellimm.2012.11.009 Kai-Larsen Y, Agerberth B. The role of the multifunctional peptide LL-37 in host defense. Frontiers in Bioscience (2008). DOI: 10.2741/2997Mechanism of Action
Membrane Disruption and Lipid Selectivity
The primary antimicrobial mechanism of LL-37 involves direct interaction with and disruption of microbial cell membranes. In aqueous solution, LL-37 exists as a largely unstructured peptide, but upon encountering lipid bilayers or membrane-mimetic environments, it undergoes a conformational transition to an amphipathic alpha-helical structure spanning approximately residues 2 through 31. This helix presents a hydrophobic face that inserts into the lipid bilayer and a cationic face that interacts with negatively charged lipid headgroups.
A critical feature of LL-37’s antimicrobial selectivity is its ability to discriminate between bacterial and mammalian membrane compositions. Studies using lipid monolayer models have demonstrated that LL-37 readily inserts into monolayers composed of phosphatidylglycerol (PG), the predominant anionic lipid in bacterial membranes, causing substantial structural disruption. In contrast, monolayers of phosphatidylcholine (PC) and phosphatidylethanolamine (PE), which characterize the outer leaflet of mammalian cell membranes, remained largely unaffected by LL-37 at equivalent concentrations. This lipid headgroup discrimination provides the molecular basis for the peptide’s preferential toxicity toward microbial cells over host cells.
Neville F, Cahuzac M, Konovalov O, Ishitsuka Y, Lee KYC, Kuzmenko I, Kale GM, Gidalevitz D. Lipid headgroup discrimination by antimicrobial peptide LL-37: insight into mechanism of action. Biophysical Journal (2006). DOI: 10.1529/biophysj.105.069401Detailed biophysical studies of LL-37 interaction with model microbial-like membranes have revealed that the peptide induces changes in phospholipid acyl chain conformation from all-trans to gauche configurations and significantly alters phospholipid tilt angles. These findings support a “carpet” model of membrane dissolution followed by detergent-like disruption, in which LL-37 molecules initially accumulate on the membrane surface in a parallel orientation before reaching a critical concentration threshold that triggers membrane disintegration.
Xhindoli D, Pacor S, Benincasa M, Scocchi M, Gennaro R, Tossi A. The human cathelicidin LL-37--A pore-forming antibacterial peptide and host-cell modulator. Biochimica et Biophysica Acta (2016). DOI: 10.1016/j.bbamem.2015.11.003Structural Determinants of Activity
High-resolution NMR structural studies have elucidated the three-dimensional architecture of LL-37 and mapped the functional contributions of specific residues. The long amphipathic helix contains two hydrophobic domains separated by serine 9 at the interface, which explains the peptide’s cooperative binding to bacterial lipopolysaccharides. Aromatic residues at positions 5, 6, 17, and 27 (phenylalanine residues F5, F6, F17, and F27) directly interact with anionic phosphatidylglycerols, while interfacial basic amino acids provide electrostatic anchoring to the membrane surface. The central arginine at position 23 (R23) has been identified as particularly important for both membrane binding and DNA interaction.
Wang G, Mishra B, Epand RF, Epand RM. High-quality 3D structures shine light on antibacterial, anti-biofilm and antiviral activities of human cathelicidin LL-37 and its fragments. Biochimica et Biophysica Acta (2014). DOI: 10.1016/j.bbamem.2014.01.016LPS Neutralization and Anti-Inflammatory Signaling
LL-37 binds bacterial lipopolysaccharide (LPS) with high affinity, effectively neutralizing this potent pro-inflammatory endotoxin. LPS, produced by gram-negative bacteria, is a strong inducer of inflammatory cascades through Toll-like receptor 4 (TLR4) signaling. By sequestering LPS and preventing its interaction with the TLR4/MD-2/CD14 receptor complex, LL-37 attenuates the downstream production of pro-inflammatory cytokines including TNF-alpha, IL-1-beta, and IL-6. This LPS-neutralizing capacity positions LL-37 as a modulator of the inflammatory response during bacterial infection, balancing antimicrobial activity with prevention of excessive inflammation.
In addition to LPS neutralization, LL-37 has been shown to inhibit macrophage pyroptosis, a caspase-1-dependent form of inflammatory cell death, through a dual mechanism. The peptide suppresses both the LPS-mediated priming signal and the ATP/P2X7-mediated activation signal required for NLRP3 inflammasome assembly and pyroptosis execution. This dual inhibitory action on pyroptosis may contribute to the protective effects of LL-37 observed in sepsis models.
Hu Z, Murakami T, Suzuki K, Tamura H, Kuwahara-Arai K, Iba T, Nagaoka I. Antimicrobial cathelicidin peptide LL-37 inhibits the LPS/ATP-induced pyroptosis of macrophages by dual mechanism. PLoS ONE (2014). DOI: 10.1371/journal.pone.0085765Enhancement of Phagocytosis
Research has demonstrated that LL-37 enhances the phagocytic capacity of macrophages in a dose- and time-dependent manner. Treatment with LL-37 upregulates the expression of Fc-gamma receptors (FcgammaRs) on macrophage surfaces, enhancing the uptake of IgG-opsonized gram-negative and gram-positive bacteria. The peptide also increases expression of TLR4 and CD14, further potentiating the macrophage response to bacterial challenge. This phagocytosis-promoting effect is mediated at least in part through the formyl peptide receptor 2/ALX (FPR2/ALX), providing a receptor-dependent mechanism by which LL-37 amplifies innate immune clearance of pathogens.
Wan M, van der Does AM, Tang X, Lindbom L, Agerberth B, Haeggstrom JZ. Antimicrobial peptide LL-37 promotes bacterial phagocytosis by human macrophages. Journal of Leukocyte Biology (2014). DOI: 10.1189/jlb.0513304Pharmacokinetics
The pharmacokinetic profile of LL-37 reflects its nature as a cationic amphipathic peptide with significant protein and membrane binding properties. In physiological settings, LL-37 is produced locally at sites of infection and inflammation rather than circulating systemically at high concentrations. Plasma concentrations of LL-37 in healthy individuals are typically in the low micromolar range, with substantially higher concentrations achieved locally at sites of neutrophil degranulation, epithelial secretion, and tissue injury.
At sites of active inflammation and infection, LL-37 concentrations can reach levels significantly above those found in plasma. In psoriatic lesions, concentrations as high as 300 micromolar have been detected, while in periodontal gingival crevicular fluid during periodontitis, concentrations of approximately 1 micromolar have been measured. These local concentrations are sufficient to mediate both direct antimicrobial killing (which typically requires concentrations in the range of 1 to 32 micrograms per milliliter depending on the target organism) and immunomodulatory effects.
LL-37 is susceptible to proteolytic degradation by a variety of endogenous proteases, which serves as a regulatory mechanism to control its activity and prevent excessive tissue damage. The peptide’s functional half-life in biological environments is influenced by its tendency to form oligomeric structures and to bind to plasma proteins, lipoproteins, and glycosaminoglycans, which can both protect it from degradation and modulate its biological activity. Exogenously administered LL-37 in research settings has demonstrated systemic distribution when administered intravenously, with rapid clearance consistent with proteolytic metabolism.
Svensson D, Nilsson BO. Human antimicrobial/host defense peptide LL-37 may prevent the spread of a local infection through multiple mechanisms: an update. Inflammation Research (2025). DOI: 10.1007/s00011-025-01994-0Research Applications
Antimicrobial Activity and Multidrug-Resistant Pathogens
LL-37 exhibits broad-spectrum antimicrobial activity against gram-positive and gram-negative bacteria, fungi, and certain enveloped viruses. This activity has been demonstrated across a wide range of clinically relevant pathogens and has generated particular interest in the context of multidrug-resistant (MDR) organisms, where conventional antibiotics are increasingly ineffective.
In vitro studies have shown that LL-37 displays minimum inhibitory concentrations (MICs) in the range of 16 to 32 micrograms per milliliter against MDR Acinetobacter baumannii clinical isolates. Importantly, LL-37 and its fragment KS-30 demonstrated 100 percent bactericidal activity against multiple A. baumannii strains, including four MDR clinical isolates, within 30 minutes at concentrations as low as 0.25 to 1 microgram per milliliter in time-kill experiments. No detectable cytotoxicity was observed at these efficacious concentrations in 24-hour assays.
Feng X, Sambanthamoorthy K, Palys T, Paranavitana C. The human antimicrobial peptide LL-37 and its fragments possess both antimicrobial and antibiofilm activities against multidrug-resistant Acinetobacter baumannii. Peptides (2013). DOI: 10.1016/j.peptides.2013.08.024The antifungal properties of LL-37 have also been characterized. The peptide inhibits the growth of clinically and agronomically relevant fungi including Aspergillus, Candida, Colletotrichum, Fusarium, Malassezia, Pythium, and Trichophyton species. The antifungal mechanisms involve destruction of cell wall integrity, membrane permeabilization, induction of oxidative stress, disruption of endoplasmic reticulum homeostasis, formation of autophagy-like structures, and inhibition of cell cycle progression. LL-37 may also function as an anti-virulence peptide against fungal pathogens.
Memariani M, Memariani H. Antifungal properties of cathelicidin LL-37: current knowledge and future research directions. World Journal of Microbiology and Biotechnology (2023). DOI: 10.1007/s11274-023-03839-wAnti-Biofilm Activity
One of the most therapeutically promising properties of LL-37 is its anti-biofilm activity, which operates through mechanisms distinct from its direct bactericidal effects. Biofilms, structured bacterial communities encased in a self-produced extracellular polymeric matrix, represent a major challenge in treating chronic infections because bacteria within biofilms exhibit up to 1000-fold increased resistance to conventional antibiotics.
LL-37 has been shown to inhibit biofilm formation, prevent bacterial adhesion, and disperse pre-formed biofilms at concentrations that may differ from those required for planktonic cell killing. Against MDR A. baumannii, LL-37 inhibited and dispersed biofilms at concentrations of 32 micrograms per milliliter. Truncated fragments of LL-37, including KS-30 and KR-20, also displayed anti-biofilm activities at concentrations of 64 to 128 micrograms per milliliter.
The anti-biofilm mechanism involves interference with bacterial signaling pathways related to biofilm formation, alteration of gene expression, and disruption of the extracellular matrix. While LL-37 demonstrates strong anti-biofilm potential, challenges for therapeutic development include its high production cost, reduced activity in physiological salt conditions, susceptibility to proteolytic degradation, and cytotoxicity at high concentrations. Research into structural modifications, delivery systems, and synergistic combinations aims to overcome these limitations.
Ridyard KE, Overhage J. The Potential of Human Peptide LL-37 as an Antimicrobial and Anti-Biofilm Agent. Antibiotics (2021). DOI: 10.3390/antibiotics10060650Wound Healing and Angiogenesis
LL-37 plays a documented role in the wound healing process, with evidence from both in vivo and ex vivo experimental models. In human skin, LL-37 expression is strongly upregulated following wounding, with the highest levels of its precursor hCAP18 detected at approximately 48 hours post-injury, declining to pre-injury levels upon wound closure. The peptide is detected in both the inflammatory infiltrate and the migrating epithelium at the wound edge.
Critically, chronic non-healing ulcers have been found to be deficient in hCAP18/LL-37 expression. In an ex vivo wound healing model using organ-cultured human skin, treatment with affinity-purified anti-LL-37 antibodies inhibited re-epithelialization in a concentration-dependent manner, providing functional evidence for LL-37’s role in wound closure. The absence of Ki67 proliferation marker staining in antibody-inhibited wound epithelium suggested that LL-37 contributes to epithelial cell proliferation during wound repair.
Heilborn JD, Nilsson MF, Kratz G, Weber G, Sorensen O, Borregaard N, Stahle-Backdahl M. The cathelicidin anti-microbial peptide LL-37 is involved in re-epithelialization of human skin wounds and is lacking in chronic ulcer epithelium. The Journal of Investigative Dermatology (2003). DOI: 10.1046/j.1523-1747.2003.12340.xLL-37 also induces angiogenesis, a process essential for wound neovascularization and tissue repair. In vitro studies demonstrated that LL-37 directly activates endothelial cells through formyl peptide receptor-like 1 (FPRL1), resulting in increased endothelial cell proliferation and formation of vessel-like structures. In vivo, application of LL-37 induced neovascularization in the chorioallantoic membrane assay and in a rabbit model of hind-limb ischemia. Mice deficient in CRAMP, the murine homologue of LL-37, exhibited decreased vascularization during cutaneous wound repair, confirming the physiological relevance of cathelicidin-mediated angiogenesis.
Koczulla R, von Degenfeld G, Kupatt C, et al.. An angiogenic role for the human peptide antibiotic LL-37/hCAP-18. The Journal of Clinical Investigation (2003). DOI: 10.1172/JCI17545Immunomodulation and Sepsis Research
LL-37 functions as a multifaceted immunomodulator with context-dependent pro-inflammatory and anti-inflammatory effects. The peptide acts as an alarmin, recruiting immune cells including neutrophils, monocytes, and T-lymphocytes to sites of infection through chemotactic activity. It modulates cytokine production, enhances phagocytosis, and regulates inflammatory cell death pathways.
In murine sepsis models using cecal ligation and puncture (CLP), intravenous administration of LL-37 significantly improved survival through multiple protective mechanisms. LL-37 suppressed the increase of damage-associated molecular patterns (DAMPs) including histone-DNA complexes and high-mobility group protein 1, as well as pro-inflammatory cytokines TNF-alpha, IL-1-beta, and soluble TREM-1 in both plasma and peritoneal fluids. The peptide also reduced bacterial burden while inducing the release of neutrophil extracellular traps (NETs), which possess independent bactericidal activity.
Nagaoka I, Tamura H, Reich J. Therapeutic Potential of Cathelicidin Peptide LL-37, an Antimicrobial Agent, in a Murine Sepsis Model. International Journal of Molecular Sciences (2020). DOI: 10.3390/ijms21175973The dual nature of LL-37’s immunomodulatory effects has significant implications for its role in disease. On one side, LL-37 promotes inflammation and immune activation to combat infection; on the other, it can suppress inflammatory cascades to prevent tissue damage. The balance of these activities appears to depend on the local tissue context, concentration, and microenvironment. This bidirectional regulatory capacity has been observed across diverse inflammatory conditions and represents both an opportunity and a challenge for therapeutic development.
Yang B, Good D, Mosaiab T, Liu W, Ni G, Kaur J, Liu X, Jessop C, Yang L, Fadhil R, Yi Z, Wei MQ. Significance of LL-37 on Immunomodulation and Disease Outcome. BioMed Research International (2020). DOI: 10.1155/2020/8349712Antiviral Activity
Structural studies have identified the central helical region of LL-37 as essential for its antiviral activity. The peptide has demonstrated activity against several viruses, including human immunodeficiency virus 1 (HIV-1) and respiratory syncytial virus (RSV). The antiviral mechanism involves direct disruption of viral envelopes, which share lipid bilayer characteristics susceptible to amphipathic helical peptide insertion. LL-37 may also interfere with viral attachment and entry into host cells through interactions with both viral surface components and host cell receptors.
Wang G, Mishra B, Epand RF, Epand RM. High-quality 3D structures shine light on antibacterial, anti-biofilm and antiviral activities of human cathelicidin LL-37 and its fragments. Biochimica et Biophysica Acta (2014). DOI: 10.1016/j.bbamem.2014.01.016Safety Profile
LL-37 has been characterized extensively in preclinical models, and its safety profile reflects the typical considerations for cationic antimicrobial peptides. The peptide demonstrates cytotoxicity to human cells at concentrations that are generally higher than those required for antimicrobial activity, providing a therapeutic window for potential applications. Against MDR A. baumannii, no detectable toxicity was observed at 24 hours when LL-37 was administered at its efficacious bactericidal doses. However, at elevated concentrations (typically above 8 micromolar in cell culture systems), LL-37 can reduce cell proliferation, inhibit DNA synthesis, and induce apoptosis in several human cell types.
The peptide’s cytotoxicity is concentration-dependent and varies by cell type. In periodontal ligament cells, LL-37 at 0.1 to 1 micromolar exhibited anti-inflammatory properties without cytotoxicity, while concentrations of 8 micromolar strongly reduced cell viability through apoptotic mechanisms. These findings underscore the importance of concentration optimization in any therapeutic application.
Key challenges for therapeutic development include the high cost of peptide synthesis, reduced antimicrobial activity in physiological salt and serum conditions, susceptibility to proteolytic degradation by host and bacterial proteases, and the potential for hemolytic activity at supratherapeutic concentrations. Research into LL-37 derivatives, cyclized analogs, delivery systems, and synergistic combinations seeks to optimize the therapeutic index while retaining the peptide’s broad-spectrum activity.
van Harten RM, van Woudenbergh E, van Dijk A, Haagsman HP. Cathelicidins: Immunomodulatory Antimicrobials. Vaccines (2018). DOI: 10.3390/vaccines6030063Dosing in Research
The following table summarizes representative dosing parameters from published preclinical research. Dosing varies substantially based on the experimental model, route of administration, and research endpoint.
| Model | Route | Concentration/Dose | Duration | Key Outcome | Reference |
|---|---|---|---|---|---|
| In vitro (MDR A. baumannii) | Direct application | MIC: 16-32 mcg/mL; bactericidal: 0.25-1 mcg/mL | 30 min (time-kill) | 100% bactericidal activity against MDR isolates | Feng et al., 2013 |
| In vitro (Biofilm, A. baumannii) | Direct application | 32 mcg/mL (inhibition and dispersal) | 24 hours | Biofilm inhibition and dispersal | Feng et al., 2013 |
| In vitro (Macrophage pyroptosis) | Cell culture | 1-10 mcM | Variable | Inhibition of LPS/ATP-induced pyroptosis | Hu et al., 2014 |
| In vitro (Phagocytosis) | Cell culture | 1-5 mcM | 24 hours | Enhanced macrophage bacterial phagocytosis | Wan et al., 2014 |
| Murine (CLP sepsis) | Intravenous | Variable | Acute | Improved survival, reduced cytokines, enhanced NETs | Nagaoka et al., 2020 |
| Ex vivo (Wound healing) | Topical (organ culture) | Anti-LL-37 Ab inhibition assay | 48-72 hours | LL-37 required for re-epithelialization | Heilborn et al., 2003 |
| In vivo (Rabbit, angiogenesis) | Local application | Variable | Days | Neovascularization in ischemia model | Koczulla et al., 2003 |
Molecular Properties
| Property | Value |
|---|---|
| Full Name | Cathelicidin antimicrobial peptide LL-37 |
| Precursor Protein | hCAP18 (human cationic antimicrobial protein 18) |
| Gene | CAMP (chromosome 3p21.31) |
| Molecular Formula | C205H340N60O53 |
| Molecular Weight | 4493.33 g/mol |
| Amino Acid Sequence | [LL-37, 37 aa] (37 residues) |
| Net Charge (pH 7) | +6 (cationic) |
| Secondary Structure | Amphipathic alpha-helix (residues 2-31 in membrane-mimetic environments) |
| Isoelectric Point | ~11.1 (highly basic) |
| Form | Lyophilized powder (synthetic) |
| Appearance | White to off-white powder |
| Solubility | Soluble in water, PBS, and DMSO |
| Processing Enzyme | Proteinase 3 (cleaves hCAP18 to release LL-37) |
Storage and Handling
Lyophilized LL-37 should be stored at -20 degrees Celsius for long-term stability. Under these conditions, the peptide maintains its structural integrity and biological activity for extended periods, typically 24 months or longer when kept in a desiccated environment protected from light. For ultra-long-term archival storage, -80 degrees Celsius is recommended.
Upon reconstitution in sterile water, phosphate-buffered saline (PBS), or dimethyl sulfoxide (DMSO), solutions should be stored at 2-8 degrees Celsius and used within 14 days. Due to the amphipathic nature of LL-37 and its well-documented tendency to form oligomeric structures in aqueous solution at physiological concentrations, researchers should be aware of potential adsorption to container surfaces. The use of low-binding polypropylene tubes and tips is strongly recommended to minimize peptide loss.
Repeated freeze-thaw cycles should be avoided, as they promote aggregation and may reduce biological activity. For experiments requiring multiple uses, single-use aliquoting at the time of initial reconstitution is the preferred approach. Reconstituted solutions should be clear and colorless; the presence of turbidity or visible particulates may indicate peptide aggregation or degradation. It is important to note that LL-37 activity is sensitive to high ionic strength conditions and the presence of serum proteins, which should be accounted for in experimental design.
Current Research Landscape
LL-37 remains at the forefront of antimicrobial peptide research, with several areas of active investigation that may shape future therapeutic and diagnostic applications:
-
Novel antimicrobial therapeutics: The escalating crisis of antibiotic resistance has intensified interest in LL-37 and its derivatives as alternative or adjunctive antimicrobial agents. Research is focused on structural modifications to the LL-37 sequence, including truncated variants (KR-12, KR-20, KS-30), cyclized analogs with improved proteolytic stability, and hybrid peptides that combine elements of LL-37 with other antimicrobial peptides. Synergistic combinations of LL-37 with conventional antibiotics, particularly colistin and polymyxins against gram-negative MDR pathogens, represent an active area of investigation.
-
Anti-biofilm strategies: The ability of LL-37 to disrupt bacterial biofilms at sub-bactericidal concentrations has generated interest in peptide-coated medical devices, wound dressings, and surface treatments designed to prevent biofilm-associated infections. Research into immobilization techniques and controlled-release delivery systems aims to maintain local LL-37 concentrations at levels sufficient for anti-biofilm activity while minimizing systemic exposure.
-
Wound healing applications: The documented role of LL-37 in promoting re-epithelialization and angiogenesis, combined with the observation that chronic wounds are deficient in cathelicidin expression, has prompted research into topical LL-37 formulations for recalcitrant wounds. Peptide delivery through hydrogels, nanoparticles, and electrospun scaffolds is being explored to achieve sustained local release.
-
Immunomodulatory applications: The ability of LL-37 to modulate innate immune responses, including its capacity to suppress pyroptosis, induce NET formation, enhance phagocytosis, and neutralize endotoxin, continues to be investigated in the context of sepsis, inflammatory conditions, and immune dysregulation. The development of innate defense regulator peptides inspired by LL-37 represents a translational approach to harnessing its immunomodulatory properties.
-
Vitamin D-cathelicidin axis: The discovery that vitamin D3 signaling is a major regulator of LL-37 expression has opened an important area of investigation linking nutritional status to innate immune competence. Research continues to explore how vitamin D supplementation modulates cathelicidin levels and susceptibility to infectious diseases, with implications for public health strategies.
-
Structural biology and peptide engineering: Continued advances in structural characterization of LL-37 and its interactions with membranes, receptors, and biological targets inform the rational design of next-generation antimicrobial peptides with optimized activity, selectivity, stability, and pharmacokinetic properties.
References
The studies referenced throughout this monograph represent a selection of the published scientific literature on LL-37 and human cathelicidin biology. The field continues to expand rapidly, with new publications appearing regularly across immunology, microbiology, infectious disease, and biomaterials journals. For a comprehensive and up-to-date bibliography, researchers are encouraged to search PubMed using the terms “LL-37,” “cathelicidin,” “hCAP18,” or “CAMP gene” for the most current publications.
References
- Vandamme D, Landuyt B, Luyten W, Schoofs L (2012). A comprehensive summary of LL-37, the factotum human cathelicidin peptide. Cellular Immunology. DOI: 10.1016/j.cellimm.2012.11.009
- Xhindoli D, Pacor S, Benincasa M, Scocchi M, Gennaro R, Tossi A (2016). The human cathelicidin LL-37--A pore-forming antibacterial peptide and host-cell modulator. Biochimica et Biophysica Acta. DOI: 10.1016/j.bbamem.2015.11.003
- Kai-Larsen Y, Agerberth B (2008). The role of the multifunctional peptide LL-37 in host defense. Frontiers in Bioscience. DOI: 10.2741/2997
- Heilborn JD, Nilsson MF, Kratz G, Weber G, Sorensen O, Borregaard N, Stahle-Backdahl M (2003). The cathelicidin anti-microbial peptide LL-37 is involved in re-epithelialization of human skin wounds and is lacking in chronic ulcer epithelium. The Journal of Investigative Dermatology. DOI: 10.1046/j.1523-1747.2003.12340.x
- Koczulla R, von Degenfeld G, Kupatt C, et al. (2003). An angiogenic role for the human peptide antibiotic LL-37/hCAP-18. The Journal of Clinical Investigation. DOI: 10.1172/JCI17545
- Ridyard KE, Overhage J (2021). The Potential of Human Peptide LL-37 as an Antimicrobial and Anti-Biofilm Agent. Antibiotics. DOI: 10.3390/antibiotics10060650
- Feng X, Sambanthamoorthy K, Palys T, Paranavitana C (2013). The human antimicrobial peptide LL-37 and its fragments possess both antimicrobial and antibiofilm activities against multidrug-resistant Acinetobacter baumannii. Peptides. DOI: 10.1016/j.peptides.2013.08.024
- Yang B, Good D, Mosaiab T, Liu W, Ni G, Kaur J, Liu X, Jessop C, Yang L, Fadhil R, Yi Z, Wei MQ (2020). Significance of LL-37 on Immunomodulation and Disease Outcome. BioMed Research International. DOI: 10.1155/2020/8349712
- Hu Z, Murakami T, Suzuki K, Tamura H, Kuwahara-Arai K, Iba T, Nagaoka I (2014). Antimicrobial cathelicidin peptide LL-37 inhibits the LPS/ATP-induced pyroptosis of macrophages by dual mechanism. PLoS ONE. DOI: 10.1371/journal.pone.0085765
- Memariani M, Memariani H (2023). Antifungal properties of cathelicidin LL-37: current knowledge and future research directions. World Journal of Microbiology and Biotechnology. DOI: 10.1007/s11274-023-03839-w
- Neville F, Cahuzac M, Konovalov O, Ishitsuka Y, Lee KYC, Kuzmenko I, Kale GM, Gidalevitz D (2006). Lipid headgroup discrimination by antimicrobial peptide LL-37: insight into mechanism of action. Biophysical Journal. DOI: 10.1529/biophysj.105.069401
- Wan M, van der Does AM, Tang X, Lindbom L, Agerberth B, Haeggstrom JZ (2014). Antimicrobial peptide LL-37 promotes bacterial phagocytosis by human macrophages. Journal of Leukocyte Biology. DOI: 10.1189/jlb.0513304
- Nagaoka I, Tamura H, Reich J (2020). Therapeutic Potential of Cathelicidin Peptide LL-37, an Antimicrobial Agent, in a Murine Sepsis Model. International Journal of Molecular Sciences. DOI: 10.3390/ijms21175973
- Wang G, Mishra B, Epand RF, Epand RM (2014). High-quality 3D structures shine light on antibacterial, anti-biofilm and antiviral activities of human cathelicidin LL-37 and its fragments. Biochimica et Biophysica Acta. DOI: 10.1016/j.bbamem.2014.01.016
- van Harten RM, van Woudenbergh E, van Dijk A, Haagsman HP (2018). Cathelicidins: Immunomodulatory Antimicrobials. Vaccines. DOI: 10.3390/vaccines6030063
- Svensson D, Nilsson BO (2025). Human antimicrobial/host defense peptide LL-37 may prevent the spread of a local infection through multiple mechanisms: an update. Inflammation Research. DOI: 10.1007/s00011-025-01994-0
